PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 324943
Common NameARALYDRAFT_324943
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 310aa    MW: 34070.4 Da    PI: 5.6151
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
324943genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-124892147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I   +g  +t  q++s+ qky
           324943 48 RESWTEGEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 92
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-164298IPR009057Homeodomain-like
PROSITE profilePS5129414.9424397IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-64698IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-184695IPR006447Myb domain, plants
SMARTSM007177.6E-104795IPR001005SANT/Myb domain
PfamPF002493.3E-104892IPR001005SANT/Myb domain
CDDcd001671.51E-75093No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MTSSNPVVAE VLPSETSTDA TETTLTTTEA GEAPEKKVRK AYTITKSRES WTEGEHDKFL  60
EALQLFDRDW KKIEDFVGSK TVIQIRSHAQ KYFLKVQKNG TLAHVPPPRP KRKAAHPYPQ  120
KASKNAQMSL HVSMSFPTQI NNLPGYTSWD DDTSALLNIA VTGVIPPEDE LELDTLCGAE  180
GMRSHLYSVF VFCFVVVGSN GMISETSPSA SGIGSSSRTL SDSKGLRVVK QAPSMHGLPD  240
FAEVYNFIGS VFDPDSKGRM KKLKEMDPIN FETVLLLMRN LTVNLSNPDF EPASEYVDAA  300
EEGHEHLSS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00484DAPTransfer from AT5G02840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ9372090.0AJ937209.1 Arabidopsis thaliana mRNA for myb transcription factor LHY-CCA1-like1 (lcl1 gene).
GenBankAK3170120.0AK317012.1 Arabidopsis thaliana AT5G02840 mRNA, complete cds, clone: RAFL16-09-C03.
GenBankAY0428940.0AY042894.1 Arabidopsis thaliana putative protein (F9G14_150) mRNA, complete cds.
GenBankAY0815220.0AY081522.1 Arabidopsis thaliana putative protein (At5g02840) mRNA, complete cds.
GenBankAY5195140.0AY519514.1 Arabidopsis thaliana MYB transcription factor (At5g02840) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002870992.10.0hypothetical protein ARALYDRAFT_324943
SwissprotQ6R0G40.0RVE4_ARATH; Protein REVEILLE 4
TrEMBLD7M7W60.0D7M7W6_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60001630.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152131118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02840.21e-159LHY/CCA1-like 1